PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA52G00008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 532aa    MW: 58812.4 Da    PI: 6.1691
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA52G00008genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-184087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ede+l+d+vk++G g+W+++ ++  + R++k+c++rw ++l
       AA52G00008 40 KGPWTTGEDEILIDYVKKHGEGNWNAVQKHTSLSRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding51.62.1e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ + ++G++ W++ a++++ gRt++++k++w++
       AA52G00008  93 KGAFSQEEEQLIVEMHSKMGNK-WARMAEHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.013587IPR017930Myb domain
SuperFamilySSF466893.26E-3038134IPR009057Homeodomain-like
SMARTSM007177.1E-153989IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-234194IPR009057Homeodomain-like
CDDcd001672.04E-114287No hitNo description
PfamPF139211.5E-1543103No hitNo description
PROSITE profilePS5129425.78688142IPR017930Myb domain
SMARTSM007171.2E-1692140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2595141IPR009057Homeodomain-like
CDDcd001674.24E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MSYTTTESDD AMQSSIHNES PAADISNGCR SRWKGSALKK GPWTTGEDEI LIDYVKKHGE  60
GNWNAVQKHT SLSRCGKSCR LRWANHLRPN LKKGAFSQEE EQLIVEMHSK MGNKWARMAE  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PGMHVEVMQW SEEYTENKLI GTDRGPQDFL  180
QLGNCKTNVL FDGLNFSTSG MLPSASELSD IVGCNILGTC ATSSQYESFV QPTLLSPKLL  240
GDFGSRFPGC SSNIKHEYPS PEHYQNSALQ RNPRSSSFSP CDVDPLYGNQ HSSDMISDSH  300
TVSDGLLTTS KPLFGAVKLE LPSFQYPPDS TFDQWKTTTP SSPHSDLLDS VDAYIQSPPP  360
SSLQDPDSFS SCDTGLLDML LHEAKIKTSA KHSSDHTTKI KSEEYGGDSL KNLAHSEIPS  420
QDGVSSGHVI KSEELSQIYG QKRQQSWRVS SSTSSVPDIT RPDVLLASSS SWLDHHHQGF  480
GIVRDSSSMS DALAVLLGDE IGNTYMNMSV GTSSSSCAWT NMPQICQMME LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-322914113127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882732.10.0hypothetical protein ARALYDRAFT_478481
TrEMBLD7LAN10.0D7LAN1_ARALL; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65